missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Inositol Monophosphatase 3/IMPAD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Inositol Monophosphatase 3/IMPAD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Inositol Monophosphatase 3/IMPAD1 Polyclonal specifically detects Inositol Monophosphatase 3/IMPAD1 in Human samples. It is validated for Western Blot.Specifications
| Inositol Monophosphatase 3/IMPAD1 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| EC 3.1.3, EC 3.1.3.25, FLJ20421, IMP 3, IMPA3IMPase 3, inositol monophosphatase 3, inositol monophosphatase domain containing 1, Inositol monophosphatase domain-containing protein 1, Inositol-1(or 4)-monophosphatase 3, Myo-inositol monophosphatase A3 | |
| IMPAD1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NX62 | |
| 54928 | |
| Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the middle region of IMPAD1. Peptide sequence TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title