INO80 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58955-25ul

Produktkod. 18621757

Beskrivning

INO80 Polyclonal specifically detects INO80 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifikationer

• Antigen: INO80
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 3.6.1, EC 3.6.1.23, EC 3.6.4.12, hINO80INO80 complex subunit A, homolog of yeast INO80, Ino80, INO80 complex homolog 1 (S. cerevisiae), INO80 homolog (S. cerevisiae), INO80A, INOC1putative DNA helicase INO80 complex homolog 1, KIAA1259
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54617
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: INO80
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRQQRKLNFLITQTELYAHFMSRKRDMGHDGIQEEILRKLEDSSTQRQIDIGGGVVVNITQEDYDSNHFKAQALKNAENAYHIHQARTRSFDEDAKESR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only