missing translation for 'onlineSavingsMsg'
Learn More
Learn More
INMT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | INMT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
INMT Polyclonal specifically detects INMT in Human samples. It is validated for Western Blot.Specifications
| INMT | |
| Polyclonal | |
| Rabbit | |
| O95050 | |
| 11185 | |
| Synthetic peptides corresponding to INMT(indolethylamine N-methyltransferase) The peptide sequence was selected from the N terminal of INMT (NP_006765). Peptide sequence KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Amine N-methyltransferase, Aromatic alkylamine N-methyltransferase, Arylamine N-methyltransferase, EC 2.1.1, EC 2.1.1.49, Indolamine N-methyltransferase, indolethylamine N-methyltransferase, MGC125940, MGC125941, nicotine N-methyltransferase | |
| INMT | |
| IgG | |
| 29 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title