missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Indoleamine 2,3-dioxygenase/IDO Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
£203.00 - £460.00
Specifications
| Antigen | Indoleamine 2,3-dioxygenase/IDO |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18468071
|
Novus Biologicals
NBP1-87702-25ul |
25 μL |
£203.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18701774
|
Novus Biologicals
NBP1-87702 |
0.1 mL |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Indoleamine 2,3-dioxygenase/IDO Polyclonal specifically detects Indoleamine 2,3-dioxygenase/IDO in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Indoleamine 2,3-dioxygenase/IDO | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P14902 | |
| 3620 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 45 kDa |
| Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 1.13.11.52, IDOIDO-1, INDOindole 2,3-dioxygenase, indoleamine 2,3-dioxygenase 1, indoleamine-pyrrole 2,3 dioxygenase, Indoleamine-pyrrole 2,3-dioxygenase | |
| IDO1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title