ILT11/LILRA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18353324	Novus Biologicals NBP3-09519-100UL	100 μg

Description

ILT11/LILRA5 Polyclonal specifically detects ILT11/LILRA5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ILT11/LILRA5
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CD85, CD85 antigen-like family member F, CD85F, CD85f antigen, ILT-11, ILT11CD85f, Immunoglobulin-like transcript 11, leukocyte Ig-like receptor 9, Leukocyte immunoglobulin-like receptor 9, leukocyte immunoglobulin-like receptor subfamily A member 5, leukocyte immunoglobulin-like receptor subfamily A member 5 soluble, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LILRB7, LIR-9, LIR9immunoglobulin-like transcript 11 protein, member 7
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ILT11/LILRA5 (NP_870994). Peptide sequence GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH
• Purification Method: Affinity purified

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 353514
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.