missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL18R1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | IL18R1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IL18R1 Polyclonal specifically detects IL18R1 in Human samples. It is validated for Western Blot.Specifications
| IL18R1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CD218 antigen-like family member A, CD218a, CD218a antigen, CDw218a, cytokine receptor, IL-18R1, IL-18R-1, IL1R-rp, IL1RRPIL1 receptor-related protein, IL-1RrpIL18RA, interleukin 18 receptor 1, interleukin-18 receptor 1 | |
| IL18R1 | |
| IgG | |
| 60 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q13478 | |
| 8809 | |
| Synthetic peptides corresponding to IL18R1(interleukin 18 receptor 1) The peptide sequence was selected from the N terminal of IL18R1. Peptide sequence PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title