missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-27R alpha/WSX-1/TCCR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21361-25ul
This item is not returnable.
View return policy
Description
IL-27R alpha/WSX-1/TCCR Polyclonal antibody specifically detects IL-27R alpha/WSX-1/TCCR in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| IL-27R alpha/WSX-1/TCCR | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| class I cytokine receptor, CRL1IL-27R, Cytokine receptor-like 1, IL27R, IL-27RA, IL-27R-alpha, interleukin 27 receptor, alpha, interleukin-27 receptor subunit alpha, TCCRIL-27 receptor subunit alpha, T-cell cytokine receptor type 1, Type I T-cell cytokine receptor, WSX-1, WSX1IL-27R subunit alpha, zcytor1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL | |
| 25 μL | |
| Apoptosis, Cytokine Research | |
| 9466 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunocytochemistry | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction