IL-2 R beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18481622	Novus Biologicals NBP2-34148-25ul	25 μL
18175952	Novus Biologicals NBP2-34148	0.1 mL

Description

IL-2 R beta Polyclonal specifically detects IL-2 R beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IL-2 R beta
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P14784
• Gene ID (Entrez): 3560
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Immunology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD122, CD122 antigen, high affinity IL-2 receptor beta subunit, High affinity IL-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, interleukin 15 receptor, beta, interleukin 2 receptor, beta, interleukin-2 receptor subunit beta, P70-75, p75
• Gene Symbols: IL2RB
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only