missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-17RA/IL-17R Rabbit anti-Mouse, Rat, Clone: 6Q2U9, Novus Biologicals™
Shop All Bio Techne ProductsDescription
IL-17RA/IL-17R Monoclonal antibody specifically detects IL-17RA/IL-17R in Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | IL-17RA/IL-17R |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 6Q2U9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | CD217, CD217 antigen, CDw217interleukin 17 receptor, hIL-17R, IL-17 receptor A, IL-17RAMGC10262, IL17Rinterleukin-17 receptor A, interleukin 17 receptor A |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 767-866 of human IL-17RA/IL-17R (Q96F46). GCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?