missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-17D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | IL-17D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IL-17D Polyclonal specifically detects IL-17D in Human samples. It is validated for Western Blot.Specifications
| IL-17D | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research | |
| FLJ30846, IL-17Dinterleukin 27, IL-22, IL-27interleukin-17D, IL27interleukin-27, interleukin 17D, Interleukin-27 | |
| IL17D | |
| IgG | |
| 21 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_612141 | |
| 53342 | |
| Synthetic peptide directed towards the N terminal of human IL17DThe immunogen for this antibody is IL17D. Peptide sequence MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title