IL-13R alpha 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69687

Product Code. 18286002

Description

IL-13R alpha 2 Polyclonal specifically detects IL-13R alpha 2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IL-13R alpha 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cancer/testis antigen 19, CD213a2, CD213a2 antigen, CT19, IL-13 receptor subunit alpha-2, IL13BP, IL13R, IL-13R, IL-13R subunit alpha-2, IL-13RA2, IL-13R-alpha-2, interleukin 13 binding protein, interleukin 13 receptor alpha 2 chain, interleukin 13 receptor, alpha 2, interleukin-13 receptor subunit alpha-2, Interleukin-13-binding protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 3598
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q14627
• Gene Symbols: IL13RA2
• Immunogen: Synthetic peptides corresponding to IL13RA2(interleukin 13 receptor, alpha 2) The peptide sequence was selected from the middle region of IL13RA2. Peptide sequence GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha-2.
• Target Species: Human, Rat, Rabbit
• Isotype: IgG

For Research Use Only