IL-1 RII Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-86550

Product Code. 18249737

Description

IL-1 RII Polyclonal specifically detects IL-1 RII in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IL-1 RII
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: beta, CD121b, CD121b antigen, IL1RBCD121 antigen-like family member B, IL-1R-beta, IL-1RT2, IL-1RT-2, interleukin 1 receptor, type II, Interleukin-1 receptor beta, MGC47725
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: IL1R2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDK
• Quantity: 0.1 mL
• Research Discipline: Cancer, Signal Transduction
• Gene ID (Entrez): 7850
• Target Species: Human
• Isotype: IgG

For Research Use Only