missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-1 RI Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48589
This item is not returnable.
View return policy
Description
IL-1 RI Polyclonal antibody specifically detects IL-1 RI in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| IL-1 RI | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CD121 antigen-like family member A, CD121a antigen, IL1R, IL1R1, IL1RT1, IL-1RT1, IL-1RT-1, Interleukin 1 Receptor 1, interleukin 1 receptor, type I, interleukin receptor 1, interleukin-1 receptor type 1, p80 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLF | |
| 0.1 mL | |
| Cancer, Cytokine Research, Immunology, Innate Immunity | |
| 3554 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction