missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IKZF5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | IKZF5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18210723
|
Novus Biologicals
NBP2-58346 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631938
|
Novus Biologicals
NBP2-58346-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IKZF5 Polyclonal specifically detects IKZF5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| IKZF5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 64376 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVEVSLDENSGMLVDGFERTFDGK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| DKFZp781B0249, FLJ22973, IKAROS family zinc finger 5 (Pegasus), Ikaros family zinc finger protein 5, PEGASUS, zinc finger protein Pegasus, zinc finger protein, subfamily 1A, 5, zinc finger protein, subfamily 1A, 5 (Pegasus), zinc finger transcription factor Pegasus, ZNFN1A5 | |
| IKZF5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title