missing translation for 'onlineSavingsMsg'
Learn More

IKBKAP Antibody (6G9), Novus Biologicals™

Product Code. 18359109 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18359109 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18359109 Supplier Novus Biologicals Supplier No. H00008518M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

IKBKAP Monoclonal antibody specifically detects IKBKAP in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen IKBKAP
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 6G9
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003631
Gene Alias DYS, elongator complex protein 1, ELP1DKFZp781H1425, FD, FLJ12497, IKAPdysautonomia (Riley-Day syndrome, hereditary sensory autonomic neuropathy typeIII), IkappaB kinase complex-associated protein, IKI3, IKK complex-associated protein, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinasecomplex-associated protein, p150, TOT1
Host Species Mouse
Immunogen IKBKAP (NP_003631, 1242 a.a. ~ 1331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 8518
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.