IKB zeta Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10987-100UL

Product Code. 18350652

Description

IKB zeta Polyclonal specifically detects IKB zeta in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: IKB zeta
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ30225, FLJ34463, ikappaBzeta, I-kappa-B-zeta, IkappaB-zeta, ikbzeta, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAPIkappa B-zeta variant 3, MAILIKBZikB-zeta, Molecule possessing ankyrin repeats induced by lipopolysaccharide, NF-kappa-B inhibitor zeta, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse IKB zeta (NP_001152866.1). Peptide sequence VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64332
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.