Ikaros/IKZF1 Rabbit anti-Human, Mouse, Clone: 4S10I3, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-16223-100UL

Product Code. 18337955

Description

Ikaros/IKZF1 Monoclonal antibody specifically detects Ikaros/IKZF1 in Human, Mouse samples. It is validated for Western Blot, ChIP assay, Immunofluorescence

Specifications

• Antigen: Ikaros/IKZF1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified

• Applications: ChIP Assay, Immunofluorescence
• Clone: 4S10I3
• Dilution: Western Blot 1:50 - 1:200, Chromatin Immunoprecipitation 1:20 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: DNA-binding protein Ikaros, hIk-1, IK1LyF-1, Ikaros (zinc finger protein), IKAROS family zinc finger 1 (Ikaros), Ikaros family zinc finger protein 1, IKAROSLymphoid transcription factor LyF-1, LYF1PRO0758, zinc finger protein, subfamily 1A, 1 (Ikaros), ZNFN1A1CLL-associated antigen KW-6
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros/IKZF1 (Q13422). AEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL
• Quantity: 100 μg
• Research Discipline: Innate Immunity
• Gene ID (Entrez): 10320
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG