missing translation for 'onlineSavingsMsg'
Learn More

Ikaros/IKZF1 Rabbit anti-Human, Mouse, Clone: 4S10I3, Novus Biologicals™

Product Code. 18337955 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18337955 100 μg 100µL
18344065 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18337955 Supplier Novus Biologicals Supplier No. NBP316223100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

Ikaros/IKZF1 Monoclonal antibody specifically detects Ikaros/IKZF1 in Human, Mouse samples. It is validated for Western Blot, ChIP assay, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Ikaros/IKZF1
Applications ChIP Assay, Immunofluorescence
Classification Monoclonal
Clone 4S10I3
Conjugate Unconjugated
Dilution Western Blot 1:50 - 1:200, Chromatin Immunoprecipitation 1:20 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias DNA-binding protein Ikaros, hIk-1, IK1LyF-1, Ikaros (zinc finger protein), IKAROS family zinc finger 1 (Ikaros), Ikaros family zinc finger protein 1, IKAROSLymphoid transcription factor LyF-1, LYF1PRO0758, zinc finger protein, subfamily 1A, 1 (Ikaros), ZNFN1A1CLL-associated antigen KW-6
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros/IKZF1 (Q13422). AEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 10320
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.