missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18358439

IHPK2 Antibody (1C6), Novus Biologicals™

Product Code. 18358439 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18358439 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18358439 Supplier Novus Biologicals Supplier No. H00051447M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

IHPK2 Monoclonal antibody specifically detects IHPK2 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen IHPK2
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1C6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Alias EC 2.7.4.21, IHPK2ATP:1D-myo-inositol-hexakisphosphate phosphotransferase, inositol hexakisphosphate kinase 2, inositol hexaphosphate kinase 2, InsP6 kinase 2, P(i)-uptake stimulator, pi uptake stimulator, PIUS
Host Species Mouse
Immunogen IP6K2 (NP_001005912.1, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVS
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 51447
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.