missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IGFLR1/TMEM149 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69417
This item is not returnable.
View return policy
Description
IGFLR1/TMEM149 Polyclonal specifically detects IGFLR1/TMEM149 in Human samples. It is validated for Western Blot.
Specifications
| IGFLR1/TMEM149 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ22573, transmembrane protein 149, U2 small nuclear RNA auxiliary factor 1-like 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 4, U2AF1L4 | |
| Rabbit | |
| 38 kDa | |
| 100 μL | |
| Signal Transduction | |
| 79713 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9H665 | |
| IGFLR1 | |
| Synthetic peptides corresponding to TMEM149(transmembrane protein 149) The peptide sequence was selected from the N terminal of TMEM149. Peptide sequence WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction