IGFLR1/TMEM149 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69417

Product Code. 18262644

Description

IGFLR1/TMEM149 Polyclonal specifically detects IGFLR1/TMEM149 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IGFLR1/TMEM149
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ22573, transmembrane protein 149, U2 small nuclear RNA auxiliary factor 1-like 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 4, U2AF1L4
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 79713
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H665
• Gene Symbols: IGFLR1
• Immunogen: Synthetic peptides corresponding to TMEM149(transmembrane protein 149) The peptide sequence was selected from the N terminal of TMEM149. Peptide sequence WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only