missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IGFBP-rp1/IGFBP-7 Rabbit anti-Human, Mouse, Rat, Clone: 8M10Q9, Novus Biologicals™
Shop All Bio Techne ProductsDescription
IGFBP-rp1/IGFBP-7 Monoclonal antibody specifically detects IGFBP-rp1/IGFBP-7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
Specifications
Specifications
| Antigen | IGFBP-rp1/IGFBP-7 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 8M10Q9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | angiomodulin, FSTL2, IBP-7, IGFBP-7PGI2-stimulating factor, IGFBP-7v, IGFBP-rP1, IGFBPRP1, insulin-like growth factor binding protein 7, insulin-like growth factor-binding protein 7, MAC25 protein, MAC25IGF-binding protein 7, Prostacyclin-stimulating factor, PSFAGM, TAF, Tumor-derived adhesion factor |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGFBP-rp1/IGFBP-7 (Q16270). LGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQ |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?