IGF2BP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35366-100ul

Product Code. 30228054

Description

IGF2BP1 Polyclonal antibody specifically detects IGF2BP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: IGF2BP1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
• Gene Alias: Coding region determinant-binding protein, CRD-BP, CRDBPIGF-II mRNA-binding protein 1, IGF II mRNA binding protein 1, IMP1, IMP-1ZBP-1, insulin-like growth factor 2 mRNA binding protein 1, insulin-like growth factor 2 mRNA-binding protein 1, VICKZ family member 1, VICKZ1, ZBP1IGF2 mRNA-binding protein 1, Zip code-binding protein 1, Zipcode-binding protein 1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 478-577 of human IGF2BP1 (NP_006537.3).,, Sequence:, FGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10642
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG