missing translation for 'onlineSavingsMsg'
Learn More

IFN-alpha F/IFNA21 Antibody, Novus Biologicals™

Product Code. 18367298 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18367298 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18367298 Supplier Novus Biologicals Supplier No. H00003452D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

IFN-alpha F/IFNA21 Polyclonal antibody specifically detects IFN-alpha F/IFNA21 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen IFN-alpha F/IFNA21
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH69329.1
Gene Alias IFN-alpha-21, IFN-alphaI, interferon alpha-21, Interferon alpha-F, interferon, alpha 21, LeIF F, leukocyte interferon protein, MGC126687, MGC126689
Host Species Rabbit
Immunogen IFNA21 (AAH69329.1, 1 a.a. - 189 a.a.) full-length human protein. MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 3452
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.