missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IFIT5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | IFIT5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IFIT5 Polyclonal specifically detects IFIT5 in Human samples. It is validated for Western Blot.Specifications
| IFIT5 | |
| Polyclonal | |
| Rabbit | |
| Q13325 | |
| 24138 | |
| Synthetic peptides corresponding to IFIT5(interferon-induced protein with tetratricopeptide repeats 5) The peptide sequence was selected from the middle region of IFIT5. Peptide sequence ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ53857, IFIT-5, interferon-induced protein with tetratricopeptide repeats 5, Retinoic acid- and interferon-inducible 58 kDa protein, retinoic acid- and interferon-inducible protein (58kD), RI58FLJ92678 | |
| IFIT5 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title