missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ID4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35655-20ul
This item is not returnable.
View return policy
Description
ID4 Polyclonal antibody specifically detects ID4 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| ID4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| bHLHb27BHLHB27, Class B basic helix-loop-helix protein 27, DNA-binding protein inhibitor ID-4, IDB4, Inhibitor of DNA binding 4, inhibitor of DNA binding 4, dominant negative helix-loop-helix protein | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ID4 (NP_001537.1).,, Sequence:, MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY | |
| 20 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 3400 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction