missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18348678

Novus Biologicals™ ID4 Antibody, Novus Biologicals™

Product Code. 18348678 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18348678 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18348678 Supplier Novus Biologicals™ Supplier No. H00003400B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

ID4 Polyclonal antibody specifically detects ID4 in Human,Mouse samples. It is validated for Immunocytochemistry/ Immunofluorescence,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ID4
Applications Immunocytochemistry/Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_001537
Gene Alias bHLHb27BHLHB27, Class B basic helix-loop-helix protein 27, DNA-binding protein inhibitor ID-4, IDB4, Inhibitor of DNA binding 4, inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
Host Species Mouse
Immunogen ID4 (NP_001537, 1 a.a. - 161 a.a.) full-length human protein. MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3400
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.