missing translation for 'onlineSavingsMsg'
Learn More

ICB1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Código de producto. 18358405 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
100 μg
25 μg
Tamaño de la unidad:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18358405 100 μg 100µL
18340235 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18358405 Proveedor Novus Biologicals N.º de proveedor NBP317264100UL

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

ICB1 Polyclonal antibody specifically detects ICB1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen ICB1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias basement membrane-induced, chromosome 1 open reading frame 38, ICB1, ICB-1, Induced by contact to basement membrane 1 protein, Protein ICB-1, protein THEMIS2, THEMIS2, Thymocyte-expressed molecule involved in selection protein 2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9473
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.