ICB1 Antibody, Novus Biologicals™

Artikelnummer.	Quantity	unitSize
18404432	25 μL	25µL
18295936	0.1 mL	0.1mL

Artikelnummer. 18404432 Lieferant Novus Biologicals Lieferanten-Nr. NBP18784925ul

Beschreibung

Rabbit Polyclonal Antibody

ICB1 Polyclonal specifically detects ICB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: ICB1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: basement membrane-induced, chromosome 1 open reading frame 38, ICB1, ICB-1, Induced by contact to basement membrane 1 protein, Protein ICB-1, protein THEMIS2, THEMIS2, Thymocyte-expressed molecule involved in selection protein 2
• Gene Symbols: THEMIS2
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:WTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHMRRTIVKIPSTLEVDVEDVTASSRHVHFIKPLLLS
• Purification Method: Affinity Purified
• Quantity: 25 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9473
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only