missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ICA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ICA1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
ICA1 Polyclonal specifically detects ICA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| ICA1 | |
| Unconjugated | |
| RUO | |
| Q05084 | |
| 3382 | |
| Synthetic peptides corresponding to ICA1(islet cell autoantigen 1, 69kDa) The peptide sequence was selected from the N terminal of ICA1. Peptide sequence SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Diabetes Research, Growth and Development, Neuronal Cell Markers | |
| diabetes mellitus type I autoantigen, ICA69, ICAp69Islet cell autoantigen p69,69 kDa islet cell autoantigen, islet cell autoantigen 1, islet cell autoantigen 1 (69kD), islet cell autoantigen 1 isoform, islet cell autoantigen 1, 69kDa, p69 | |
| ICA1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title