IBRDC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-37941-25ul

Product Code. 18649215

Description

IBRDC2 Polyclonal specifically detects IBRDC2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IBRDC2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q7Z419
• Gene Symbols: RNF144B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIF
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: bA528A10.3, E3 ubiquitin-protein ligase RNF144B, EC 6.3.2, EC 6.3.2.-, IBR domain containing 2, IBR domain-containing protein 2, IBRDC2, KIAA0161, p53-inducible RING finger protein, P53RFP, PIR2, ring finger protein 144BMGC71786
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 255488
• Target Species: Human
• Isotype: IgG