missing translation for 'onlineSavingsMsg'
Learn More
Learn More
hydroxysteroid (17-beta) dehydrogenase 11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-90334
This item is not returnable.
View return policy
Description
hydroxysteroid (17-beta) dehydrogenase 11 Polyclonal specifically detects hydroxysteroid (17-beta) dehydrogenase 11 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| hydroxysteroid (17-beta) dehydrogenase 11 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| 17betaHSD11, 17betaHSDXI, 17-beta-hydroxysteroid dehydrogenase 11, 17-beta-hydroxysteroid dehydrogenase type XI, 17-beta-hydroxysteroid dehydrogenase XI, 17bHSD11, CTCL-associated antigen HD-CL-03, dehydrogenase/reductase (SDR family) member 8, DHRS8, EC 1.1.1, EC 1.1.1.62, hydroxysteroid (17-beta) dehydrogenase 11, member 2,17-beta-HSD 11, PAN1BRETSDR2,17-BETA-HSD11, retSDR2, RetSDR2,17-BETA-HSDXI, SDR16C2,17BHSD11, T-cell lymphoma-associated antigen HD-CL-03,17-beta-HSD XI | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HSD17B11 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGY | |
| 0.1 mL | |
| Lipid and Metabolism | |
| 51170 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction