missing translation for 'onlineSavingsMsg'
Learn More

Hydroxyacid Oxidase-1/HAO-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18333532
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18333532 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18333532 Supplier Bio-Techne Supplier No. NBP316999100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Hydroxyacid Oxidase-1/HAO-1 Polyclonal antibody specifically detects Hydroxyacid Oxidase-1/HAO-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Hydroxyacid Oxidase-1/HAO-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias (S)-2-hydroxy-acid oxidase, EC 1.1.3.15, Glycolate oxidase, GOX1MGC142227, GOXMGC142225, HAOX1, hydroxyacid oxidase (glycolate oxidase) 1, hydroxyacid oxidase 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline metabolism, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 54363
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.