missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Hydroxyacid Oxidase-1/HAO-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£288.00 - £451.00
Specifications
| Antigen | Hydroxyacid Oxidase-1/HAO-1 |
|---|---|
| Dilution | Western Blot 0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000-1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18461082
|
Novus Biologicals
NBP2-14080-25ul |
25 μL |
£288.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18451582
|
Novus Biologicals
NBP2-14080 |
0.1 mL |
£451.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Hydroxyacid Oxidase-1/HAO-1 Polyclonal antibody specifically detects Hydroxyacid Oxidase-1/HAO-1 in Human, Canine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Hydroxyacid Oxidase-1/HAO-1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| metabolism, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 54363 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000-1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Canine | |
| (S)-2-hydroxy-acid oxidase, EC 1.1.3.15, Glycolate oxidase, GOX1MGC142227, GOXMGC142225, HAOX1, hydroxyacid oxidase (glycolate oxidase) 1, hydroxyacid oxidase 1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title