missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Hyaluronan Synthase 3/HAS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£231.00 - £451.00
Specifications
| Antigen | Hyaluronan Synthase 3/HAS3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18452431
|
Novus Biologicals
NBP1-86328-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18798203
|
Novus Biologicals
NBP1-86328 |
0.1 mL |
£451.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Hyaluronan Synthase 3/HAS3 Polyclonal specifically detects Hyaluronan Synthase 3/HAS3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Hyaluronan Synthase 3/HAS3 | |
| Unconjugated | |
| RUO | |
| EC 2.4.1.212, HA synthase 3, hyaluronan synthase 3, Hyaluronate synthase 3, Hyaluronic acid synthase 3 | |
| HAS3 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Hyaluronan Synthase 3/HAS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3038 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title