Invitrogen™ Human ZWINT Control Fragment Recombinant Protein

Product Code. 30200284

Brand: Invitrogen™ RP88825

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82216 (PA5-82216. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is clearly involved in kinetochore function although an exact role is not known. It interacts with ZW10, another kinetochore protein, possibly regulating the association between ZW10 and kinetochores. The encoded protein localizes to prophase kinetochores before ZW10 does and it remains detectable on the kinetochore until late anaphase. It has a uniform distribution in the cytoplasm of interphase cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O95229
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11130
• Name: Human ZWINT Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010007E07Rik; 2600001N01Rik; D10Ertd749e; human ZW10 interacting protein-1; HZwint-1; KNTC2AP; neuroprotective protein 8; scoilin; Sip30; SNAP25 interacting protein 30; SNAP25 interacting protein of 30 kDa; SNAP25-interacting protein 30; ZW10 interacting kinetochore protein; ZW10 interacting protein-1; ZW10 interactor; ZW10 interactor, kinetochore protein; ZW10-interacting protein 1; ZWINT; ZWINT1; Zwint-1
• Common Name: ZWINT
• Gene Symbol: ZWINT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVRERKTGTQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining