Invitrogen™ Human ZW10 (aa 35-134) Control Fragment Recombinant Protein

Product Code. 30200402

Brand: Invitrogen™ RP103214

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63124 (PA5-63124. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division.

Specifications

• Accession Number: O43264
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9183
• Name: Human ZW10 (aa 35-134) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330566F14Rik; centromere/kinetochore protein zw10; centromere/kinetochore protein zw10 homolog; H KNTC1AP; HZW10; KNTC1AP; LOW QUALITY PROTEIN: centromere/kinetochore protein zw10 homolog; MGC149821; MmZw10; Unknown (protein for MGC:139579); zeste white 10 homolog; Zw10; ZW10 homolog, centromere/kinetochore protein; zw10 kinetochore protein; ZW10, kinetochore associated, homolog
• Common Name: ZW10
• Gene Symbol: ZW10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDIDLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAIEEYNCALTEKKYVTG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining