Invitrogen™ Human ZSWIM5 (aa 576-668) Control Fragment Recombinant Protein

Product Code. 30196155

Brand: Invitrogen™ RP90810

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53756 (PA5-53756. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9P217
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57643
• Name: Human ZSWIM5 (aa 576-668) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KIAA1511; Zinc finger SWIM domain-containing protein 5; zinc finger SWIM-type containing 5; zinc finger, SWIM domain containing 5; zinc finger, SWIM-type containing 5; ZSWIM5
• Common Name: ZSWIM5
• Gene Symbol: ZSWIM5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLEIYKHQKKELLQRGTTTITNLEGWVGHPLDPIDCLFLTLTEACRLNDDGYLEMSDMNESRPPVYQHVPVAAGSPNSSESYLSLALEVALMG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining