Invitrogen™ Human ZSWIM3 (aa 601-692) Control Fragment Recombinant Protein

Artikelnummer. 30195697

missing translation for 'mfr': Invitrogen™ RP107010

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66332 (PA5-66332. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZSWIM3 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include zinc ion binding.

Spezifikation

• Accession Number: Q96MP5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 140831
• Name: Human ZSWIM3 (aa 601-692) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921517A06Rik; C20orf164; C86566; PPP1R174; protein phosphatase 1, regulatory subunit 174; zinc finger SWIM domain-containing protein 3; zinc finger SWIM-type containing 3; zinc finger, SWIM domain containing 3; zinc finger, SWIM-type containing 3; ZSWIM3
• Common Name: ZSWIM3
• Gene Symbol: ZSWIM3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGMVPNTGQPEKQGRNDMIQDLSRELANLLMQTEGPELEERYSTLRKIVDIWAGPSQPSELFQQPGDFKDVGRLPFLWGKQEEGEGFPPATA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining