Invitrogen™ Human ZSCAN9 (aa 135-195) Control Fragment Recombinant Protein

Product Code. 30211949

Brand: Invitrogen™ RP101311

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63801 (PA5-63801. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF193 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 SCAN box domain. ZNF193 may be involved in transcriptional regulation.

Specifications

• Accession Number: O15535
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7746
• Name: Human ZSCAN9 (aa 135-195) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cell proliferation-inducing gene 12 protein; cell proliferation-inducing protein 12; PIG12; PRD51; zinc finger and SCAN domain containing 9; zinc finger and SCAN domain-containing protein 9; Zinc finger protein 193; ZNF193; ZSCAN9
• Common Name: ZSCAN9
• Gene Symbol: ZSCAN9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEPQHEMVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSAQKCHSIGETDEVTKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining