Invitrogen™ Human ZRANB2 (aa 3-83) Control Fragment Recombinant Protein

Product Code. 30212248

Brand: Invitrogen™ RP101663

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84178 (PA5-84178. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. ZNF265 (Zinc finger protein 265), also known as ZRANB2 (Zinc finger Ran-binding domain-containing protein 2), ZIS, ZIS1 or ZIS2, is a 330 amino acid protein that belongs to the ZRANB2 family. Localized to the nucleus, ZNF265 functions as a splicing factor that is responsible for alternatively splicing Tra-2 beta (transformer-2 beta) transcripts and is thought to interfere with constitutive 5'-splice selection. ZNF265 contains two RanBP2-type zinc fingers through which it conveys its RNA-binding activity. Two isoforms, designated ZIS-1 and ZIS-2, are expressed due to alternative splicing events. Upon DNA damage, ZIS-2 may be phosphorylated by ATM or ATR.

Specifications

• Accession Number: O95218
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9406
• Name: Human ZRANB2 (aa 3-83) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI227013; DKFZp686J1831; DKFZp686N09117; wu:fa96h03; Zfp265; zgc:56597; zinc finger protein 265; Zinc finger Ran-binding domain-containing protein 2; Zinc finger Ran-binding domain-containing protein 2-like protein; zinc finger RANBP2-type containing 2; zinc finger, RAN-binding domain containing 2; zinc finger, splicing; zinc-finger protein 265; zinc-finger, splicing; ZIS; ZIS1; ZIS2; Znf265; ZRANB2
• Common Name: ZRANB2
• Gene Symbol: Zranb2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining