Invitrogen™ Human ZPR1 (aa 102-188) Control Fragment Recombinant Protein

Product Code. 30210313

Brand: Invitrogen™ RP102583

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83171 (PA5-83171. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is found in the cytoplasm of quiescent cells but translocates to the nucleolus in proliferating cells. The encoded protein interacts with survival motor neuron protein (SMN1) to enhance pre-mRNA splicing and to induce neuronal differentiation and axonal growth. Defects in this gene or the SMN1 gene can cause spinal muscular atrophy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Specifications

• Accession Number: O75312
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8882
• Name: Human ZPR1 (aa 102-188) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI303781; fc17g10; hypothetical protein LOC504523; RGD1562173; si:rp71-56i13.4; wu:fc17g10; Zfp259; zgc:56478; Zinc finger protein 259; zinc finger protein ZPR1; ZNF259; Zpr1; ZPR1 zinc finger
• Common Name: ZPR1
• Gene Symbol: ZPR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining