Invitrogen™ Human ZP4 (aa 41-148) Control Fragment Recombinant Protein

Product Code. 30211893

Brand: Invitrogen™ RP90149

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52577 (PA5-52577. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mammalian zona pellucida is composed of four major glycoproteins, ZP1, ZP2, ZP3 and ZP4, which may act as sperm receptors. Two forms of porcine ZP4 peptides exist: one consisting of 128 amino acid residues and the other of 133 amino acid residues. These two peptides are identical, except the larger form contains an additional five amino acid sequence at its carboxy-terminal end. Both peptides have two potential N-linked glycosylation sites. The smaller peptide shares 39.1% identity with the amino-terminal region of mouse ZP2 polypeptide. Based on results from animal studies, ZP4 antigen is a promising candidate for the development of a contraceptive vaccine.

Specifications

• Accession Number: Q12836
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57829
• Name: Human ZP4 (aa 41-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Processed zona pellucida sperm-binding protein 4; ZBP; zona pellucida 4; zona pellucida B glycoprotein; zona pellucida glycoprotein 4; Zona pellucida protein B; zona pellucida sperm-binding protein 4; ZP1; ZP4; Zp-4; ZPB
• Common Name: ZP4
• Gene Symbol: ZP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDSIPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining