missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZP4 (aa 41-148) Control Fragment Recombinant Protein

Product Code. 30211893
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211893

Brand: Invitrogen™ RP90149

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52577 (PA5-52577. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mammalian zona pellucida is composed of four major glycoproteins, ZP1, ZP2, ZP3 and ZP4, which may act as sperm receptors. Two forms of porcine ZP4 peptides exist: one consisting of 128 amino acid residues and the other of 133 amino acid residues. These two peptides are identical, except the larger form contains an additional five amino acid sequence at its carboxy-terminal end. Both peptides have two potential N-linked glycosylation sites. The smaller peptide shares 39.1% identity with the amino-terminal region of mouse ZP2 polypeptide. Based on results from animal studies, ZP4 antigen is a promising candidate for the development of a contraceptive vaccine.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12836
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57829
Name Human ZP4 (aa 41-148) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Processed zona pellucida sperm-binding protein 4; ZBP; zona pellucida 4; zona pellucida B glycoprotein; zona pellucida glycoprotein 4; Zona pellucida protein B; zona pellucida sperm-binding protein 4; ZP1; ZP4; Zp-4; ZPB
Common Name ZP4
Gene Symbol ZP4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDSIPA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.