Invitrogen™ Human ZNRF2 (aa 105-182) Control Fragment Recombinant Protein

Product Code. 30197094

Brand: Invitrogen™ RP108596

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84890 (PA5-84890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitination is an important mechanism through which three classes of enzymes act in concert to target short-lived or abnormal proteins for destruction. The three classes of enzymes involved in ubiquitination are the ubiquitin-activating enzymes (E1s), the ubiquitin-conjugating enzymes (E2s) and the ubiquitin-protein ligases (E3s). ZNRF2 (zinc and ring finger 2), also known as RNF202, is a 242 amino acid peripheral membrane protein that contains one RING-type zinc finger and localizes to the lysosome, as well as the endosome and the cell junction. Expressed at high levels in brain tissue, ZNRF2 is thought to function as an E3 ubiquitin-protein ligase that may be involved in the establishment and maintenance of neuronal transmission and plasticity. Upon DNA damage, ZNRF2 is subject to phosphorylation, probably by ATR or ATM.

Specifications

• Accession Number: Q8NHG8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 223082
• Name: Human ZNRF2 (aa 105-182) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190002C14Rik; AU044205; D6Ertd365e; E3 ubiquitin-protein ligase ZNRF2; protein Ells2; RING finger protein 202; RING-type E3 ubiquitin transferase ZNRF2; RNF202; zinc and ring finger 1; zinc and ring finger 2; zinc and ring finger 2, E3 ubiquitin protein ligase; zinc finger/RING finger 2; zinc/RING finger protein 2; Znrf1; Znrf2
• Common Name: ZNRF2
• Gene Symbol: Znrf2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining