Invitrogen™ Human ZNHIT6 (aa 173-275) Control Fragment Recombinant Protein

Product Code. 30209713

Brand: Invitrogen™ RP91618

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53736 (PA5-53736. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for box C/D snoRNAs accumulation involved in snoRNA processing, snoRNA transport to the nucleolus and ribosome biogenesis. [UniProt]

Specifications

• Accession Number: Q9NWK9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54680
• Name: Human ZNHIT6 (aa 173-275) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410019A14Rik; BCD1; box C/D snoRNA essential 1 homolog; box C/D snoRNA protein 1; box C/d snoRNA protein 1-like protein; C1orf181; C3H1ORF181; FLJ20729; NY-BR-75; RGD1308723; Serologically defined breast cancer antigen NY-BR-75; zinc finger HIT domain-containing protein 6; zinc finger HIT-type containing 6; zinc finger, HIT type 6; zinc finger, HIT-type containing 6; Znhit6
• Common Name: ZNHIT6
• Gene Symbol: ZNHIT6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining