missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210335

Invitrogen™ Human ZNHIT1 (aa 6-67) Control Fragment Recombinant Protein

Product Code. 30210335
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210335

Brand: Invitrogen™ RP92676

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53903 (PA5-53903. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Seems to play a role in p53-mediated apoptosis induction (PubMed:17380123). Binds to NR1D2 and relieves it of its inhibitory effect on the transcription of APOC3 without affecting its DNA-binding activity (PubMed:17892483). [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43257
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10467
Name Human ZNHIT1 (aa 6-67) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700001K05Rik; CG1I; CGBP1; Cyclin-G1-binding protein 1; H_DJ0747G18.14; hypothetical protein LOC407699; p18 Hamlet; p18Hamlet; putative cyclin G1 interacting protein; similar to Zinc finger HIT domain containing protein 1 (Cyclin G1-binding protein 1); zgc:112524; zgc:112524 protein; zinc finger HIT domain-containing protein 1; zinc finger HIT-type containing 1; zinc finger protein subfamily 4 A member 1; zinc finger protein, subfamily 4 A (HIT domain containing), member 1; zinc finger, HIT domain containing 1; zinc finger, HIT type 1; zinc finger, HIT-type containing 1; ZNFN4A1; ZNHIT1
Common Name ZNHIT1
Gene Symbol ZNHIT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.