Invitrogen™ Human ZNF746 (aa 381-444) Control Fragment Recombinant Protein

Product Code. 30195075

Brand: Invitrogen™ RP92816

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54172 (PA5-54172. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF746 is a transcription repressor that specifically binds to the 5'-TATTTT[T/G]-3' consensus sequence on promoters and represses transcription of PGC-1-alpha (PPARGC1A), thereby playing a role in regulation of neuron death.

Specifications

• Accession Number: Q6NUN9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 155061
• Name: Human ZNF746 (aa 381-444) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810407L07Rik; AI317225; LOW QUALITY PROTEIN: zinc finger protein 746; PARIS; parkin interacting substrate; parkin-interacting substrate; parkin-interacting sustrate; Zfp746; Zinc finger protein 746; Znf746
• Common Name: ZNF746
• Gene Symbol: ZNF746
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining