Invitrogen™ Human ZNF71 (aa 9-147) Control Fragment Recombinant Protein

Product Code. 30201832

Brand: Invitrogen™ RP91316

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82614 (PA5-82614. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kruppel-related zinc finger protein,endothelial zinc finger protein induced by tumor necrosis factor alpha.

Specifications

• Accession Number: Q9NQZ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 58491
• Name: Human ZNF71 (aa 9-147) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Endothelial zinc finger protein induced by tumor necrosis factor alpha; endothelial zinc finger protein induced by tumor necrosis factor alpha; zinc finger protein 470; EZFIT; Kruppel-related zinc finger protein; zinc finger protein 71; ZNF71
• Common Name: ZNF71
• Gene Symbol: ZNF71
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining