Invitrogen™ Human ZNF598 (aa 300-413) Control Fragment Recombinant Protein

Product Code. 30181833

Brand: Invitrogen™ RP98748

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59712 (PA5-59712. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF598 (E3 ubiquitin-protein ligase ZNF598) plays a key role in the ribosome quality control (RQC). RQC is a pathway that takes place when a ribosome has stalled during translation. It is required for ribosomes to terminally stall during translation of poly(A) sequences by mediating monoubiquitination of 40A ribosomal protein RPS10/eS10 and RPS3/uS3. Stalling precludes synthesis of a long poly-lysine tail and initiated the RQC pathway to degrade the potentially detrimental aberrant nascent polypeptide.

Specifications

• Accession Number: Q86UK7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90850
• Name: Human ZNF598 (aa 300-413) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC023040; C6orf149; E3 ubiquitin-protein ligase ZNF598; FLJ00086; ISD11; Ntrap; Zfp598; Zinc finger protein 598; ZNF598
• Common Name: ZNF598
• Gene Symbol: ZNF598
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDQEEGGRPKKEEAAARGPEDPRGPRRSPRTQGEGPGPKETSTNGPVSQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining