Invitrogen™ Human ZNF592 (aa 258-368) Control Fragment Recombinant Protein

Product Code. 30210168

Brand: Invitrogen™ RP91690

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54467 (PA5-54467. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is thought to play a role in a complex developmental pathway and the regulation of genes involved in cerebellar development. Mutations in this gene have been associated with autosomal recessive spinocerebellar ataxia. [provided by RefSeq, Jan 2011].

Specifications

• Accession Number: Q92610
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9640
• Name: Human ZNF592 (aa 258-368) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430405N24; A730014M16Rik; CAMOS; KIAA0211; mKIAA0211; SCAR5; Zfp592; Zfp-592; Zinc finger protein 592; ZNF592
• Common Name: ZNF592
• Gene Symbol: ZNF592
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining