missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZNF536 (aa 1103-1194) Control Fragment Recombinant Protein

Product Code. 30203966
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203966

Brand: Invitrogen™ RP93653

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85029 (PA5-85029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF536 is a recently identified zinc-finger protein that is expressed primarily in the developing nervous system and the cerebral cortex, hippocampus, and hypothalamus. ZNF536 possess ten zinc fingers and interacts with CtBP1, a corepressor for gene transcription. It is most closely related to transcriptional repressor ZNF219. Overexpression of ZNF536 in embryonic stem cells dramatically reduced the mRNA levels of neuronal marker genes such as Pax6, MAP2, and beta-tubulin III following retinoic acid (RA)-induced differentiation, while depletion of ZNF536 via RNAi resulted in elevated mRNA levels of these genes, indicating its role in inhibiting neuronal cell differentiation. Overexpression of RA receptor a rescues the inhibitory role of ZNF536, suggesting that ZNF536 might inhibit RA response element-mediated transcriptional activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15090
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9745
Name Human ZNF536 (aa 1103-1194) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9630010P11Rik; KIAA0390; mKIAA0390; RGD1563363; Zfp536; Zinc finger protein 536; Znf536
Common Name ZNF536
Gene Symbol ZNF536
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AFCNFPSDFYKQFGVYPGMVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMMTKPL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.